PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr041150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 259aa    MW: 29773.1 Da    PI: 7.9055
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr041150.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS268.42.4e-821257120373
         GRAS 120 sqGlQWpaLlqaLasRp.....egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl....vakrledleleeLrvkpgEalaVnlvl 208
                  ++G+QWp+L+qaL +R+     ++pp+lRiT+ g+    + + l +tgerL +fA++lg+ f+f++l    +++  + +++++L ++++E+laVn+vl
  Pbr041150.1   1 MHGVQWPPLMQALVERSynsplHPPPTLRITATGR----DLTLLLRTGERLLRFAQSLGLAFQFHPLvlnnTSQPSDLISPSTLGLHQNEVLAVNCVL 94 
                  58***************87777779**********....9***************************555444456778******************* PP

         GRAS 209 qlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerr 306
                   lh+l+ ++         +L+ +ksl+Pkv++++++ea+hn++ F++rf+eal++y a+fdslea+lp++s+er +vE+  +grei++vv  eg++r+
  Pbr041150.1  95 YLHTLVTDDSRD---LFLFLQKIKSLNPKVFTIANKEANHNNHLFFNRFVEALDHYGAVFDSLEATLPPNSRERLVVEEW-FGREIKDVVGIEGEKRK 188
                  *****9444433...4589***********************************************************97.***************** PP

         GRAS 307 erhetlek.WrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                  +rhe++e+ W+  l++aGF++vpls +a +qaklllr ++ s+gy++   ++s++lgW++rpL+svS+W
  Pbr041150.1 189 QRHESYETfWEVVLRRAGFENVPLSPFALSQAKLLLRLHYpSEGYQLRIFNDSFFLGWQNRPLFSVSSW 257
                  *****9977************************************************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035148.1E-801257IPR005202Transcription factor GRAS
PROSITE profilePS5098536.4721237IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MHGVQWPPLM QALVERSYNS PLHPPPTLRI TATGRDLTLL LRTGERLLRF AQSLGLAFQF  60
HPLVLNNTSQ PSDLISPSTL GLHQNEVLAV NCVLYLHTLV TDDSRDLFLF LQKIKSLNPK  120
VFTIANKEAN HNNHLFFNRF VEALDHYGAV FDSLEATLPP NSRERLVVEE WFGREIKDVV  180
GIEGEKRKQR HESYETFWEV VLRRAGFENV PLSPFALSQA KLLLRLHYPS EGYQLRIFND  240
SFFLGWQNRP LFSVSSWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-361258119375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC3079590.0KC307959.1 Malus x domestica lateral suppressor protein (LAS1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009346546.10.0PREDICTED: scarecrow-like protein 18
RefseqXP_009374432.10.0PREDICTED: scarecrow-like protein 18
SwissprotQ9ZWC52e-98SCL18_ARATH; Scarecrow-like protein 18
TrEMBLM4PMF01e-179M4PMF0_MALDO; Lateral suppressor protein
STRINGVIT_19s0015g01930.t011e-128(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF129262133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55580.15e-88GRAS family protein